EF-Hand Calcium Binding Domain 8 Antibody


Immunohistochemistry: EF-Hand Calcium Binding Domain 8 Antibody [NBP2-30742] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

EF-Hand Calcium Binding Domain 8 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGALGMDAFIKAMK
Specificity of human EF-Hand Calcium Binding Domain 8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EF-Hand Calcium Binding Domain 8 Protein (NBP2-30742PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EF-Hand Calcium Binding Domain 8 Antibody

  • EFCAB8
  • EF-Hand Calcium-Binding Domain-Containing Protein 8
  • EF-Hand Domain-Containing Protein ENSP00000383366


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742) (0)

There are no publications for EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742) (0)

There are no reviews for EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EF-Hand Calcium Binding Domain 8 Products

Bioinformatics Tool for EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742)

Discover related pathways, diseases and genes to EF-Hand Calcium Binding Domain 8 Antibody (NBP2-30742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on EF-Hand Calcium Binding Domain 8

There are no specific blogs for EF-Hand Calcium Binding Domain 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EF-Hand Calcium Binding Domain 8 Antibody and receive a gift card or discount.


Gene Symbol EFCAB8