![Western Blot: DNAJC18 Antibody [NBP1-81137] - Analysis in control (vector only transfected HEK293T lysate) and DNAJC18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/DNAJC18-Antibody-Western-Blot-NBP1-81137-img0007.jpg "Western Blot: DNAJC18 Antibody [NBP1-81137] - Analysis in control (vector only transfected HEK293T lysate) and DNAJC18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKL |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DNAJC18 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNAJC18 Antibody (NBP1-81137)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: DNAJC18 Antibody [NBP1-81137] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/DNAJC18-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81137-img0003.jpg "Immunocytochemistry/Immunofluorescence: DNAJC18 Antibody [NBP1-81137] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cell junctions. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DNAJC18 Antibody [NBP1-81137] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/DNAJC18-Antibody-Immunohistochemistry-Paraffin-NBP1-81137-img0006.jpg "Immunohistochemistry-Paraffin: DNAJC18 Antibody [NBP1-81137] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")