DNAH7 Antibody - BSA Free

Western Blot: DNAH7 Antibody [NBP1-93613] - Dynein arm subunits and interaction partners of ZMYND10 were downregulated in Zmynd10-/- mice. Representative immunoblot analyses of DNAH7, DNAI2, DNAI1, IQUB, LRRC6, C21ORF59, and ZMYND10 in the testis extracts from Zmynd10+/+ and Zmynd10-/- mice. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1007316), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: DNAH7 Antibody [NBP1-93613] - Staining of human fallopian tube shows positivity in cilia.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNAH7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAH7 Antibody - BSA Free (NBP1-93613) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DNAH7 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAH7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 23527195).
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific literature (PMID: 29601588)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DNAH7 Protein (NBP1-93613PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 29601588)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAH7 Antibody - BSA Free

• axonemal dynein heavy chain 7
• ciliary dynein heavy chain 7
• dynein heavy chain 7, axonemal
• dynein, axonemal, heavy chain 7
• dynein, axonemal, heavy polypeptide 7
• hDHC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNAH7 Antibody (NBP1-93613)(4)

Publications using NBP1-93613

• Kim DY, Sub YJ, Kim HY et al. LRRC6 regulates biogenesis of motile cilia by aiding FOXJ1 translocation into the nucleus Cell communication and signaling : CCS 2023-06-16 [PMID: 37328841] (Western Blot, Mouse)
• Cho KJ, Noh SH, Han SM et al. ZMYND10 stabilizes intermediate chain proteins in the cytoplasmic pre-assembly of dynein arms. PLoS Genet. 2018-03-30 [PMID: 29601588] (WB, Mouse)
• Horani A, Ferkol TW, Shoseyov D et al. LRRC6 Mutation Causes Primary Ciliary Dyskinesia with Dynein Arm Defects. PLoS One 2013-01-01 [PMID: 23527195] (ICC/IF, Human)
• Horani A, Druley TE, Zariwala MA et al. Whole-Exome Capture and Sequencing Identifies HEATR2 Mutation as a Cause of Primary Ciliary Dyskinesia Am J Hum Genet 2012-10-05 [PMID: 23040496] (ICC/IF, Human)

Review for DNAH7 Antibody (NBP1-93613) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Amjad Horani IF Human 05/30/2013

Summary

• Application: Immunofluorescence
• Sample Tested: human airway epithelial cells
• Species: Human

FAQs for DNAH7 Antibody (NBP1-93613). (Showing 1 - 1 of 1 FAQs).

1. I wonder if there is any publications using this antibody? We plan to use for immunofluorescent staining and WB.
   • We do have one reference listed for this antibody: Horani A, Druley TE, Zariwala MA et al Whole-Exome Capture and Sequencing Identifies HEATR2 Mutation as a Cause of Primary Ciliary Dyskinesia Am J Hum Genet 2012 Oct 5 [PMID: 23040496] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: DNAH7
• Entrez:
  • 56171(Human)
  • 525893(Rat)
• Uniprot:
  • Q8WXX0(Human)