DNAH10OS Antibody


Immunohistochemistry-Paraffin: DNAH10OS Antibody [NBP1-93748] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

DNAH10OS Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH10OS Protein (NBP1-93748PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNAH10OS Antibody

  • dynein, axonemal, heavy chain 10 opposite strand


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNAH10OS Antibody (NBP1-93748) (0)

There are no publications for DNAH10OS Antibody (NBP1-93748).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAH10OS Antibody (NBP1-93748) (0)

There are no reviews for DNAH10OS Antibody (NBP1-93748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH10OS Antibody (NBP1-93748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNAH10OS Products

Bioinformatics Tool for DNAH10OS Antibody (NBP1-93748)

Discover related pathways, diseases and genes to DNAH10OS Antibody (NBP1-93748). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DNAH10OS

There are no specific blogs for DNAH10OS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNAH10OS Antibody and receive a gift card or discount.


Gene Symbol DNAH10OS