DIRAS2 Antibody

Images

 
Western Blot: DIRAS2 Antibody [H00054769-B01P] - Analysis of DIRAS2 expression in transfected 293T cell line by DIRAS2 polyclonal antibody. Lane 1: DIRAS2 transfected lysate(21.89 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DIRAS2 Antibody Summary

Immunogen
DIRAS2 (NP_060064.2, 1 a.a. - 199 a.a.) full-length human protein. MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
Specificity
DIRAS2 - DIRAS family, GTP-binding RAS-like 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DIRAS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DIRAS2 Antibody

  • DIRAS family, GTP-binding RAS-like 2
  • Di-Ras2
  • Distinct subgroup of the Ras family member 2
  • DKFZp761C07121
  • GTP-binding protein Di-Ras2

Background

DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58888
Species: Hu
Applications: WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
H00054769-B01P
Species: Hu
Applications: WB

Publications for DIRAS2 Antibody (H00054769-B01P) (0)

There are no publications for DIRAS2 Antibody (H00054769-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIRAS2 Antibody (H00054769-B01P) (0)

There are no reviews for DIRAS2 Antibody (H00054769-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIRAS2 Antibody (H00054769-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIRAS2 Products

Bioinformatics Tool for DIRAS2 Antibody (H00054769-B01P)

Discover related pathways, diseases and genes to DIRAS2 Antibody (H00054769-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIRAS2 Antibody (H00054769-B01P)

Discover more about diseases related to DIRAS2 Antibody (H00054769-B01P).
 

Pathways for DIRAS2 Antibody (H00054769-B01P)

View related products by pathway.

Research Areas for DIRAS2 Antibody (H00054769-B01P)

Find related products by research area.

Blogs on DIRAS2

There are no specific blogs for DIRAS2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIRAS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIRAS2
Entrez
Uniprot