DIP2B Antibody

Images

 
Immunohistochemistry-Paraffin: DIP2B Antibody [NBP2-14563] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIP2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSG GARDERY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIP2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DIP2B Protein (NBP2-14563PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIP2B Antibody

  • DIP2B DIP2 disco-interacting protein 2 homolog B (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DIP2B Antibody (NBP2-14563) (0)

There are no publications for DIP2B Antibody (NBP2-14563).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIP2B Antibody (NBP2-14563) (0)

There are no reviews for DIP2B Antibody (NBP2-14563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DIP2B Antibody (NBP2-14563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIP2B Products

DIP2B NBP2-14563

Bioinformatics Tool for DIP2B Antibody (NBP2-14563)

Discover related pathways, diseases and genes to DIP2B Antibody (NBP2-14563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIP2B Antibody (NBP2-14563)

Discover more about diseases related to DIP2B Antibody (NBP2-14563).
 

Pathways for DIP2B Antibody (NBP2-14563)

View related products by pathway.

PTMs for DIP2B Antibody (NBP2-14563)

Learn more about PTMs related to DIP2B Antibody (NBP2-14563).

Blogs on DIP2B

There are no specific blogs for DIP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIP2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIP2B