DHX37 Antibody - BSA Free

Immunohistochemistry-Paraffin: DHX37 Antibody [NBP2-13922] - Analysis in human skin and liver tissues. Corresponding DHX37 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: DHX37 Antibody [NBP2-13922] - Staining of human cell line MCF7 shows localization to nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DHX37 Antibody [NBP2-13922] - Staining of human duodenum shows weak to moderate positivity in nuclear membranes in glandular cells.

Immunohistochemistry-Paraffin: DHX37 Antibody [NBP2-13922] - Staining of human placenta shows moderate positivity in nuclear membranes in trophoblastic cells.

Immunohistochemistry-Paraffin: DHX37 Antibody [NBP2-13922] - Staining of human skin shows moderate positivity in nuclear membranes in squamous epithelial cells.

Immunohistochemistry-Paraffin: DHX37 Antibody [NBP2-13922] - Staining of human liver shows positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX37 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHX37 Antibody - BSA Free (NBP2-13922) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-DHX37 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX37
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHX37 Protein (NBP2-13922PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DHX37 Antibody - BSA Free

• DDX37
• DEAD/DEAH box helicase DDX37
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 37
• DEAH (Asp-Glu-Ala-His) box polypeptide 37
• DEAH box protein 37
• EC 3.6.1
• EC 3.6.4.13
• FLJ41974
• KIAA1517MGC46245
• MGC2695
• MGC4322
• probable ATP-dependent RNA helicase DHX37

Background

DHX37 encodes a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DHX37 Antibody (NBP2-13922)(1)

Publication using NBP2-13922

• Dong MB, Wang G, Chow RD et al. Systematic Immunotherapy Target Discovery Using Genome-Scale In Vivo CRISPR Screens in CD8 T Cells Cell 2019-08-22 [PMID: 31442407]

Bioinformatics

• Gene Symbol: DHX37