We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DHRS7B Antibody - BSA Free

Images

 
Western Blot: DHRS7B Antibody [NBP1-69584] - This Anti-DHRS7B antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related DHRS7B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69584
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DHRS7B Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to DHRS7B(dehydrogenase/reductase (SDR family) member 7B) The peptide sequence was selected from the middle region of DHRS7B. Peptide sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHRS7B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for DHRS7B Antibody - BSA Free

  • CGI-93
  • dehydrogenase/reductase (SDR family) member 7B
  • dehydrogenase/reductase SDR family member 7B
  • DKFZp566O084
  • EC 1.1
  • MGC8916
  • SDR32C1
  • short chain dehydrogenase/reductase family 32C, member 1

Background

This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5759
Species: Hu, Mu
Applications: WB
NBP2-30577
Species: Hu
Applications: IHC,  IHC-P
NBP1-90334
Species: Hu
Applications: ICC/IF, Simple Western, WB
NBP1-69584
Species: Hu
Applications: WB

Publications for DHRS7B Antibody (NBP1-69584) (0)

There are no publications for DHRS7B Antibody (NBP1-69584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRS7B Antibody (NBP1-69584) (0)

There are no reviews for DHRS7B Antibody (NBP1-69584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHRS7B Antibody (NBP1-69584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHRS7B Products

Research Areas for DHRS7B Antibody (NBP1-69584)

Find related products by research area.

Blogs on DHRS7B

There are no specific blogs for DHRS7B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHRS7B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRS7B
Uniprot