DENND5B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DENND5B Antibody [NBP2-31971] - Staining of human cell line U-2 OS shows localization to nucleoli & microtubules. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human testis shows moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Analysis of DENND5B expression in control and DENND5B‑knockout human adipocyte cells. Primary antibody used at 1:1000 dilution. Image from a verified customer review.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DENND5B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DENND5B Antibody - BSA Free (NBP2-31971) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DENND5B Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DENND5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated Knockout Validated from a verified customer review.
  • Western Blot Validated for Western Blot from a verified customer review.
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DENND5B Protein (NBP2-31971PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DENND5B Antibody - BSA Free

• DENN domain-containing protein 5B
• DENN/MADD domain containing 5B
• DKFZp686P1174
• FLJ41648
• FLJ43333
• MGC24039
• Rab6IP1-like protein

Background

MGC24039( AAH20855, 1 a.a. - 508 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DENND5B Antibody (NBP2-31971)(2)

Publications using NBP2-31971

• Huang Y, Zhu Y, He W Et al. Altered expression of DENND5B in patients with epilepsy and its regulation of seizures in mice Epilepsy research 2021-11-17 [PMID: 34837825] (WB, IHC-Fr, Mouse)
• Stadnicka K, Debowska M, Debski J, Bajek A. Secreting oviduct epithelial cells of Coturnix coturnix japonica (QOEC) and changes to their proteome after nonviral transfection J. Cell. Biochem. Mar 10 2019 [PMID: 30854717] (WB, Avian)

Review for DENND5B Antibody (NBP2-31971) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: YI HUANG WB Mouse 06/19/2020

Summary

• Application: Western Blot
• Sample Tested: mouse primary cell
• Species: Mouse
• Lot: R37076

Bioinformatics

• Gene Symbol: DENND5B
• Uniprot:
  • Q6ZUT9(Human)