DENND5B Antibody


Immunocytochemistry/ Immunofluorescence: DENND5B Antibody [NBP2-31971] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & microtubules.
Immunohistochemistry: DENND5B Antibody [NBP2-31971] - Staining of glioma.
Immunohistochemistry: DENND5B Antibody [NBP2-31971] - Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferus ducts.
Immunohistochemistry: DENND5B Antibody [NBP2-31971] - Staining of liver.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DENND5B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
Specificity of human DENND5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DENND5B Protein (NBP2-31971PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DENND5B Antibody

  • DENN domain-containing protein 5B
  • DENN/MADD domain containing 5B
  • DKFZp686P1174
  • FLJ41648
  • FLJ43333
  • MGC24039
  • Rab6IP1-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DENND5B Antibody (NBP2-31971) (0)

There are no publications for DENND5B Antibody (NBP2-31971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DENND5B Antibody (NBP2-31971) (0)

There are no reviews for DENND5B Antibody (NBP2-31971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DENND5B Antibody (NBP2-31971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DENND5B Products

Bioinformatics Tool for DENND5B Antibody (NBP2-31971)

Discover related pathways, diseases and genes to DENND5B Antibody (NBP2-31971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DENND5B

There are no specific blogs for DENND5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DENND5B Antibody and receive a gift card or discount.


Gene Symbol DENND5B