DCUN1D4 Antibody

Images

 
Genetic Strategies: Western Blot: DCUN1D4 Antibody [NBP1-81526] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: DCUN1D4 Antibody [NBP1-81526] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: DCUN1D4 Antibody [NBP1-81526] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Western Blot: DCUN1D4 Antibody [NBP1-81526] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-149
Western Blot: DCUN1D4 Antibody [NBP1-81526] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

DCUN1D4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FNKVMPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYE
Specificity
Specificity of human, mouse, rat DCUN1D4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCUN1D4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCUN1D4 Protein (NBP1-81526PEP)
Publications
Read Publication using NBP1-81526.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCUN1D4 Antibody

  • DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae)
  • DCN1-like protein 4
  • DCUN1 domain-containing protein 4
  • FLJ42355
  • KIAA0276Defective in cullin neddylation protein 1-like protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCUN1D4 Antibody (NBP1-81526)(1)

Reviews for DCUN1D4 Antibody (NBP1-81526) (0)

There are no reviews for DCUN1D4 Antibody (NBP1-81526). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCUN1D4 Antibody (NBP1-81526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DCUN1D4 Antibody (NBP1-81526)

Discover related pathways, diseases and genes to DCUN1D4 Antibody (NBP1-81526). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DCUN1D4

There are no specific blogs for DCUN1D4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCUN1D4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCUN1D4