DCUN1D3 Antibody

Images

 
Western Blot: DCUN1D3 Antibody [NBP1-55423] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCUN1D3 Antibody Summary

Immunogen
Synthetic peptides corresponding to DCUN1D3(DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCUN1D3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DCUN1D3 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-55423 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DCUN1D3 Antibody

  • DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)
  • DCN1-like protein 3
  • DCUN1 domain-containing protein 3
  • Defective in cullin neddylation protein 1-like protein 3
  • DKFZp686O0290
  • FLJ41725,44M2.4
  • MGC48972

Background

DCUN1D3 contains 1 DCUN1 domain. The exact function of DCUN1D3 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-55423
Species: Hu
Applications: WB

Publications for DCUN1D3 Antibody (NBP1-55423)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DCUN1D3 Antibody (NBP1-55423) (0)

There are no reviews for DCUN1D3 Antibody (NBP1-55423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DCUN1D3 Antibody (NBP1-55423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCUN1D3 Products

Bioinformatics Tool for DCUN1D3 Antibody (NBP1-55423)

Discover related pathways, diseases and genes to DCUN1D3 Antibody (NBP1-55423). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCUN1D3 Antibody (NBP1-55423)

Discover more about diseases related to DCUN1D3 Antibody (NBP1-55423).
 

Pathways for DCUN1D3 Antibody (NBP1-55423)

View related products by pathway.

Blogs on DCUN1D3

There are no specific blogs for DCUN1D3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCUN1D3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCUN1D3
Uniprot