CYB561D1 Antibody


Western Blot: CYB561D1 Antibody [NBP1-83468] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry-Paraffin: CYB561D1 Antibody [NBP1-83468] - Staining of human tonsil shows strong cytoplasmic positivity in subsets of lymphoid cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CYB561D1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Specificity of human CYB561D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYB561D1 Protein (NBP1-83468PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CYB561D1 Antibody

  • cytochrome b-561 domain containing 1
  • cytochrome b561 domain-containing protein 1
  • FLJ39035
  • FLJ44753
  • MGC138204


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CYB561D1 Antibody (NBP1-83468) (0)

There are no publications for CYB561D1 Antibody (NBP1-83468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYB561D1 Antibody (NBP1-83468) (0)

There are no reviews for CYB561D1 Antibody (NBP1-83468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYB561D1 Antibody (NBP1-83468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CYB561D1 Products

Bioinformatics Tool for CYB561D1 Antibody (NBP1-83468)

Discover related pathways, diseases and genes to CYB561D1 Antibody (NBP1-83468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CYB561D1

There are no specific blogs for CYB561D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYB561D1 Antibody and receive a gift card or discount.


Gene Symbol CYB561D1