CYB561D1 Antibody


Western Blot: CYB561D1 Antibody [NBP1-83468] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human more
Immunohistochemistry-Paraffin: CYB561D1 Antibody [NBP1-83468] - Staining of human tonsil shows strong cytoplasmic positivity in subsets of lymphoid cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

CYB561D1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
CYB561D1 Protein (NBP1-83468PEP)

Alternate Names for CYB561D1 Antibody

  • cytochrome b-561 domain containing 1
  • cytochrome b561 domain-containing protein 1
  • FLJ39035
  • FLJ44753
  • MGC138204


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CYB561D1 Antibody (NBP1-83468) (0)

There are no publications for CYB561D1 Antibody (NBP1-83468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYB561D1 Antibody (NBP1-83468) (0)

There are no reviews for CYB561D1 Antibody (NBP1-83468). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYB561D1 Antibody (NBP1-83468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CYB561D1 Antibody Products

Bioinformatics Tool for CYB561D1 Antibody (NBP1-83468)

Discover related pathways, diseases and genes to CYB561D1 Antibody (NBP1-83468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CYB561D1

There are no specific blogs for CYB561D1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CYB561D1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83468 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought