CREG2 Antibody

Images

 
Immunohistochemistry: CREG2 Antibody [NBP1-86262] - Staining of human cerebral cortex shows distinct positivity in processes.
Immunohistochemistry: CREG2 Antibody [NBP1-86262] - Staining of human hippocampus shows distinct staining in neurofilaments and moderate positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CREG2 Protein (NBP1-86262PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CREG2 Antibody

  • cellular repressor of E1A-stimulated genes 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2380
Species: Hu
Applications: WB
NBP1-86262
Species: Hu
Applications: IHC, IHC-P

Publications for CREG2 Antibody (NBP1-86262) (0)

There are no publications for CREG2 Antibody (NBP1-86262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREG2 Antibody (NBP1-86262) (0)

There are no reviews for CREG2 Antibody (NBP1-86262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CREG2 Antibody (NBP1-86262) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CREG2 Products

CREG2 NBP1-86262

Bioinformatics Tool for CREG2 Antibody (NBP1-86262)

Discover related pathways, diseases and genes to CREG2 Antibody (NBP1-86262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CREG2 Antibody (NBP1-86262)

View related products by pathway.

PTMs for CREG2 Antibody (NBP1-86262)

Learn more about PTMs related to CREG2 Antibody (NBP1-86262).

Blogs on CREG2

There are no specific blogs for CREG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREG2