COQ10B Antibody


Immunocytochemistry/ Immunofluorescence: COQ10B Antibody [NBP2-14561] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: COQ10B Antibody [NBP2-14561] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC

Order Details

COQ10B Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COQ10B Protein (NBP2-14561PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COQ10B Antibody

  • COQ10B coenzyme Q10 homolog B (S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COQ10B Antibody (NBP2-14561) (0)

There are no publications for COQ10B Antibody (NBP2-14561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ10B Antibody (NBP2-14561) (0)

There are no reviews for COQ10B Antibody (NBP2-14561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COQ10B Antibody (NBP2-14561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COQ10B Products

Research Areas for COQ10B Antibody (NBP2-14561)

Find related products by research area.

Blogs on COQ10B

There are no specific blogs for COQ10B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COQ10B Antibody and receive a gift card or discount.


Gene Symbol COQ10B