Recombinant Human CNIH3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CNIH3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 160 of Human CNIH3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS

Protein/Peptide Type
Recombinant Protein
Gene
CNIH3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CNIH3 Protein

  • CNIH-3
  • cornichon homolog 3 (Drosophila)
  • FLJ38993
  • protein cornichon homolog 3

Background

CNIH3( AAH22780, 1 a.a. - 161 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30001
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-74080
Species: Hu
Applications: WB
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84422
Species: Hu
Applications: IHC, IHC-P
NBP1-86228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30699
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-12553
Species: Hu
NBP2-55863
Species: Hu
Applications: ICC/IF

Publications for CNIH3 Recombinant Protein (H00149111-P01) (0)

There are no publications for CNIH3 Recombinant Protein (H00149111-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNIH3 Recombinant Protein (H00149111-P01) (0)

There are no reviews for CNIH3 Recombinant Protein (H00149111-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNIH3 Recombinant Protein (H00149111-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CNIH3 Products

Bioinformatics Tool for CNIH3 Recombinant Protein (H00149111-P01)

Discover related pathways, diseases and genes to CNIH3 Recombinant Protein (H00149111-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CNIH3 Recombinant Protein (H00149111-P01)

Find related products by research area.

Blogs on CNIH3

There are no specific blogs for CNIH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CNIH Antibody
NBP1-84422
CNIH2 Antibody
NBP2-30001

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CNIH3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CNIH3