Recombinant Human CML2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human CML2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 83-179 of Human CML2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NAT8B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CML2 GST (N-Term) Protein

  • Camello-like protein 2
  • CML2
  • EC 2.3.1
  • EC 2.3.1.-
  • Hcml2
  • MGC97061
  • N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene)
  • N-acetyltransferase 8B (gene/pseudogene)
  • N-acetyltransferase Camello 2
  • NAT8BP
  • probable N-acetyltransferase 8B

Background

The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47863
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00339983-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-82529
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45932
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for CML2 Partial Recombinant Protein (H00051471-Q01) (0)

There are no publications for CML2 Partial Recombinant Protein (H00051471-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CML2 Partial Recombinant Protein (H00051471-Q01) (0)

There are no reviews for CML2 Partial Recombinant Protein (H00051471-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CML2 Partial Recombinant Protein (H00051471-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CML2 Products

Bioinformatics Tool for CML2 Partial Recombinant Protein (H00051471-Q01)

Discover related pathways, diseases and genes to CML2 Partial Recombinant Protein (H00051471-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CML2 Partial Recombinant Protein (H00051471-Q01)

Discover more about diseases related to CML2 Partial Recombinant Protein (H00051471-Q01).
 

Pathways for CML2 Partial Recombinant Protein (H00051471-Q01)

View related products by pathway.

PTMs for CML2 Partial Recombinant Protein (H00051471-Q01)

Learn more about PTMs related to CML2 Partial Recombinant Protein (H00051471-Q01).
 

Research Areas for CML2 Partial Recombinant Protein (H00051471-Q01)

Find related products by research area.

Blogs on CML2

There are no specific blogs for CML2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CML2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT8B