CLCC1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CLCC1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLCC1.
  
  

  Source: E. coli

  Amino Acid Sequence: HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CLCC1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82792.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLCC1 Recombinant Protein Antigen

• chloride channel CLIC-like 1
• KIAA0761
• MCLCchloride channel CLIC-like protein 1
• Mid-1-related chloride channel 1
• Mid-1-related chloride channel protein 1
• Mid1-related chloride channel

Background

Chloride channels (CLCs) regulate cellular traffic of chloride ions, a critical component of all living cells. CLCs are involved in membrane potential stabilization, signal transduction, cell volume regulation and organic solute transport. CLCC1 (Chloride channel CLIC-like protein 1), also known as MCLC (Mid-1-related chloride channel) or KIAA0761, is a 551 amino acid multi-pass membrane protein that belongs to the chloride channel MCLC family. CLCC1 is related to the Saccharomyces cerevisiaeprotein Mid-1 and is believed to function as an intracellular chloride channel that is expressed in lung, brain, muscle, liver and testis. Localizing to intracellular compartments such as the Golgi apparatus, the endoplasmic reticulum (ER) and the nuclear envelope, CLCC1 is expressed as four isoforms due to alternative splicing events, namely hMCLC-1, hMCLC-2, hMCLC-3 and hMCLC-4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CLCC1