CLBA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C14orf79 Antibody [NBP2-14516] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: C14orf79 Antibody [NBP2-14516] - Staining of human pancreas shows moderate membranous positivity in exocrine cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLBA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C14orf79
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLBA1 Recombinant Protein Antigen (NBP2-14516PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLBA1 Antibody

  • C14orf79 chromosome 14 open reading frame 79

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLBA1 Antibody (NBP2-14516) (0)

There are no publications for CLBA1 Antibody (NBP2-14516).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLBA1 Antibody (NBP2-14516) (0)

There are no reviews for CLBA1 Antibody (NBP2-14516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CLBA1 Antibody (NBP2-14516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLBA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C14orf79