CEP27 Antibody


Western Blot: CEP27 Antibody [NBP1-89895] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CEP27 Antibody [NBP1-89895] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CEP27 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Specificity of human CEP27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEP27 Protein (NBP1-89895PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CEP27 Antibody

  • centrosomal protein 27kDa
  • Centrosomal protein of 27 kDa
  • CEP27C15orf25
  • chromosome 15 open reading frame 25
  • FLJ10460
  • HAUS augmin-like complex subunit 2
  • HAUS augmin-like complex, subunit 2
  • HsT17025


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CEP27 Antibody (NBP1-89895) (0)

There are no publications for CEP27 Antibody (NBP1-89895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP27 Antibody (NBP1-89895) (0)

There are no reviews for CEP27 Antibody (NBP1-89895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEP27 Antibody (NBP1-89895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CEP27 Products

Bioinformatics Tool for CEP27 Antibody (NBP1-89895)

Discover related pathways, diseases and genes to CEP27 Antibody (NBP1-89895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CEP27

There are no specific blogs for CEP27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CEP27 Antibody and receive a gift card or discount.


Gene Symbol HAUS2