![Immunocytochemistry/Immunofluorescence: CENPBD1 Antibody [NBP2-56651] - Staining of human cell line Hep G2 shows localization to nucleoli & vesicles.](http://images.novusbio.com/fullsize2/CENPBD1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56651-img0001.jpg "Immunocytochemistry/Immunofluorescence: CENPBD1 Antibody [NBP2-56651] - Staining of human cell line Hep G2 shows localization to nucleoli & vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV |
| Specificity | Specificity of human CENPBD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CENPBD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CENPBD1 |
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")