CDKN2A Interacting protein N-Terminal Like Antibody


Immunohistochemistry-Paraffin: CDKN2A Interacting protein N-Terminal Like Antibody [NBP2-14466] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CDKN2A Interacting protein N-Terminal Like Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSE LMK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDKN2A Interacting protein N-Terminal Like Protein (NBP2-14466PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDKN2A Interacting protein N-Terminal Like Antibody

  • CDKN2A interacting protein N-terminal like
  • CDKN2A-interacting protein N-terminal-like protein
  • CDKN2AIP N-terminal-like protein
  • MGC13017


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466) (0)

There are no publications for CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466) (0)

There are no reviews for CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDKN2A Interacting protein N-Terminal Like Products

Bioinformatics Tool for CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466)

Discover related pathways, diseases and genes to CDKN2A Interacting protein N-Terminal Like Antibody (NBP2-14466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CDKN2A Interacting protein N-Terminal Like

There are no specific blogs for CDKN2A Interacting protein N-Terminal Like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDKN2A Interacting protein N-Terminal Like Antibody and receive a gift card or discount.


Gene Symbol CDKN2AIPNL