CDHR4 Antibody

Images

 
Immunohistochemistry-Paraffin: CDHR4 Antibody [NBP2-62703] - Staining of human fallopian tube shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CDHR4 Antibody [NBP2-62703] - Analysis in human fallopian tube and prostate tissues using Anti-CDHR4 antibody. Corresponding CDHR4 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: CDHR4 Antibody [NBP2-62703] - Staining of human prostate shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CDHR4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDHR4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDHR4 Recombinant Protein Antigen (NBP2-62703PEP)

Reactivity Notes

Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CDHR4 Antibody

  • cadherin-like 29
  • cadherin-like protein 29
  • Cadherin-like protein UNQ9392/PRO34300
  • cadherin-related family member 4
  • CDH29
  • MGC164982
  • PRO34300

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDHR4 Antibody (NBP2-62703) (0)

There are no publications for CDHR4 Antibody (NBP2-62703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDHR4 Antibody (NBP2-62703) (0)

There are no reviews for CDHR4 Antibody (NBP2-62703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDHR4 Antibody (NBP2-62703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDHR4 Products

Bioinformatics Tool for CDHR4 Antibody (NBP2-62703)

Discover related pathways, diseases and genes to CDHR4 Antibody (NBP2-62703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CDHR4

There are no specific blogs for CDHR4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDHR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDHR4