CCDC64 Antibody

Images

 
Western Blot: CCDC64 Antibody [NBP2-56736] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: CCDC64 Antibody [NBP2-56736] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CCDC64 Antibody [NBP2-56736] - Staining in human kidney and liver tissues using anti-CCDC64 antibody. Corresponding CCDC64 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CCDC64 Antibody [NBP2-56736] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: CCDC64 Antibody [NBP2-56736] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CCDC64 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVT
Specificity
Specificity of human CCDC64 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC64
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC64 Recombinant Protein Antigen (NBP2-56736PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCDC64 Antibody

  • BICDR-1
  • CCDC64 coiled-coil domain containing 64
  • H_267D11.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85978
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-78735
Species: Hu
Applications: WB, IP, KD
NBP2-56736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCDC64 Antibody (NBP2-56736) (0)

There are no publications for CCDC64 Antibody (NBP2-56736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC64 Antibody (NBP2-56736) (0)

There are no reviews for CCDC64 Antibody (NBP2-56736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC64 Antibody (NBP2-56736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCDC64 Products

Bioinformatics Tool for CCDC64 Antibody (NBP2-56736)

Discover related pathways, diseases and genes to CCDC64 Antibody (NBP2-56736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC64

There are no specific blogs for CCDC64, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC64 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC64