CCDC42B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC42B Antibody [NBP2-14643] - Staining of human cell line REH shows localization to nucleus, nucleoli fibrillar center & vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CCDC42B Antibody [NBP2-14643] - Staining in human fallopian tube and prostate tissues using anti-CFAP73 antibody. Corresponding CFAP73 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: CCDC42B Antibody [NBP2-14643] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: CCDC42B Antibody [NBP2-14643] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: CCDC42B Antibody [NBP2-14643] - Staining of human prostate shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CCDC42B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC42B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC42B Protein (NBP2-14643PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC42B Antibody

  • CCDC42B coiled-coil domain containing 42B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC42B Antibody (NBP2-14643) (0)

There are no publications for CCDC42B Antibody (NBP2-14643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC42B Antibody (NBP2-14643) (0)

There are no reviews for CCDC42B Antibody (NBP2-14643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC42B Antibody (NBP2-14643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC42B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC42B