CCDC181 Antibody - BSA Free

Immunohistochemistry-Paraffin: CCDC181 Antibody [NBP1-93901] - Staining of human bronchus, fallopian tube, liver and prostate using Anti-CCDC181 antibody NBP1-93901 (A) shows similar protein distribution across tissues to independent antibody NBP1-93898 (B).

Western Blot: CCDC181 Antibody [NBP1-93901] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: CCDC181 Antibody [NBP1-93901] - Staining of human bronchus shows strong positivity in respiratory epithelial cells.

Immunohistochemistry-Paraffin: CCDC181 Antibody [NBP1-93901] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: CCDC181 Antibody [NBP1-93901] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CCDC181 Antibody [NBP1-93901] - Staining of human prostate shows no positivity in glandular cells as expected.

Analysis in human fallopian tube and prostate tissues using NBP1-93901 antibody. Corresponding CCDC181 RNA-seq data are presented for the same tissues.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC181 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCDC181 Antibody - BSA Free (NBP1-93901) is a polyclonal antibody validated for use in IHC and WB. Anti-CCDC181 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSNHRTQSAHISPVTSTYCLSPRQKELQKQLEEKREKLKREEERRKIEEEKEKKRENDIVFKAWLQKKREQVLEMRRIQRAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC181
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCDC181 Recombinant Protein Antigen (NBP1-93901PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCDC181 Antibody - BSA Free

• C1orf114
• chromosome 1 open reading frame 114
• RP1-206D15.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC181 Antibody (NBP1-93901)(1)

Publication using NBP1-93901

• Fagerberg L, Oksvold P, Skogs M et al. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). J Proteome Res 2013-06-07 [PMID: 23276153]

Bioinformatics

• Gene Symbol: CCDC181