CCDC181 Antibody

Images

 
Western Blot: C1orf114 Antibody [NBP1-93901] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining of human liver.
Western Blot: C1orf114 Antibody [NBP1-93901] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining of human nasopharynx shows strong membranous positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining in human fallopian tube and prostate tissues using anti-CCDC181 antibody. Corresponding CCDC181 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining of human bronchus, fallopian tube, liver and prostate using Anti-CCDC181 antibody NBP1-93901 (A) shows similar ...read more
Immunohistochemistry-Paraffin: C1orf114 Antibody [NBP1-93901] - Staining of human bronchus.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC181 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSNHRTQSAHISPVTSTYCLSPRQKELQKQLEEKREKLKREEERRKIEEEKEKKRENDIVFKAWLQKKREQVLEMRRIQRAK
Specificity
Specificity of human, mouse C1orf114 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1orf114
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunofluorescence fixation permeabilization: PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-93901.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%). Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC181 Antibody

  • C1orf114
  • chromosome 1 open reading frame 114
  • RP1-206D15.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC181 Antibody (NBP1-93901)(1)

Reviews for CCDC181 Antibody (NBP1-93901) (0)

There are no reviews for CCDC181 Antibody (NBP1-93901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC181 Antibody (NBP1-93901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC181 Products

Bioinformatics Tool for CCDC181 Antibody (NBP1-93901)

Discover related pathways, diseases and genes to CCDC181 Antibody (NBP1-93901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC181

There are no specific blogs for CCDC181, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC181 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1orf114