CCDC166 Antibody

Images

 
Immunohistochemistry-Paraffin: CCDC166 Antibody [NBP2-14496] - Staining of human stomach, lower shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC166 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: TSKVGSRMPSLTASRAGSRALSLVQSLEGSGISSGSSPRVSSQDTLRSTKSGPKLLSGLSRDRDPALLPPQSEDSVNAEAAAEAS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC166
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC166 Protein (NBP2-14496PEP)
Reviewed Applications
Read 1 Review rated 1
using
NBP2-14496 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC166 Antibody

  • CCDC166 coiled-coil domain containing 166

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC166 Antibody (NBP2-14496) (0)

There are no publications for CCDC166 Antibody (NBP2-14496).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CCDC166 Antibody (NBP2-14496) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-14496:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CCDC166 NBP2-14496
Enlarge
1
reviewed by:
wei xiao
WB Mouse 08/05/2021
View

Summary

ApplicationWestern Blot
Sample TestedAdult testis
SpeciesMouse
LotR12088

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC166 Antibody (NBP2-14496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

wei xiao
08/05/2021
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol CCDC166