CCDC144NL Antibody


Western Blot: CCDC144NL Antibody [NBP2-14448] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunocytochemistry/ Immunofluorescence: CCDC144NL Antibody [NBP2-14448] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & plasma membrane.
Immunohistochemistry-Paraffin: CCDC144NL Antibody [NBP2-14448] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CCDC144NL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPG EYCHLHEQRVHHHIFARGKRKGKNHVSNVV
Specificity of human CCDC144NL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC144NL Protein (NBP2-14448PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCDC144NL Antibody

  • coiled-coil domain containing 144 family, N-terminal like
  • MGC87631
  • putative coiled-coil domain-containing protein 144 N-terminal-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC144NL Antibody (NBP2-14448) (0)

There are no publications for CCDC144NL Antibody (NBP2-14448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC144NL Antibody (NBP2-14448) (0)

There are no reviews for CCDC144NL Antibody (NBP2-14448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC144NL Antibody (NBP2-14448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC144NL Products

Bioinformatics Tool for CCDC144NL Antibody (NBP2-14448)

Discover related pathways, diseases and genes to CCDC144NL Antibody (NBP2-14448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC144NL

There are no specific blogs for CCDC144NL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC144NL Antibody and receive a gift card or discount.


Gene Symbol CCDC144NL