CCDC144NL Antibody


Western Blot: CCDC144NL Antibody [NBP2-14448] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: CCDC144NL Antibody [NBP2-14448] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

CCDC144NL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPG EYCHLHEQRVHHHIFARGKRKGKNHVSNVV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
CCDC144NL Protein (NBP2-14448PEP)

Alternate Names for CCDC144NL Antibody

  • coiled-coil domain containing 144 family, N-terminal like
  • MGC87631
  • putative coiled-coil domain-containing protein 144 N-terminal-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC144NL Antibody (NBP2-14448) (0)

There are no publications for CCDC144NL Antibody (NBP2-14448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC144NL Antibody (NBP2-14448) (0)

There are no reviews for CCDC144NL Antibody (NBP2-14448). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC144NL Antibody (NBP2-14448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC144NL Antibody Products

Bioinformatics Tool for CCDC144NL Antibody (NBP2-14448)

Discover related pathways, diseases and genes to CCDC144NL Antibody (NBP2-14448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC144NL

There are no specific blogs for CCDC144NL, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CCDC144NL

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-14448 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought