CCDC124 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC124 Antibody [NBP2-48858] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CCDC124 Antibody [NBP2-48858] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 ...read more
Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 ...read more
Western Blot: CCDC124 Antibody [NBP2-48858] - IL‐25 regulates the NF‐ kappa B signaling pathway activity. A, The change of NF‐ kappa B signaling pathway in IL‐25 overexpressed A549 cells & IL‐25 silenced ...read more
Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 ...read more
Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CCDC124 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit CCDC124 Antibody - BSA Free (NBP2-48858) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CCDC124 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLRE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC124
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot Reported in scientific literature (PMID: 31044552)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC124 Recombinant Protein Antigen (NBP2-48858PEP)
Publications
Read Publication using
NBP2-48858 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCDC124 Antibody - BSA Free

  • coiled-coil domain containing 124
  • coiled-coil domain-containing protein 124

Background

CCDC124 is a coiled-coil domain containing protein of unknown function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC124 Antibody (NBP2-48858)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CCDC124 Antibody (NBP2-48858) (0)

There are no reviews for CCDC124 Antibody (NBP2-48858). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC124 Antibody (NBP2-48858) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC124 Products

Research Areas for CCDC124 Antibody (NBP2-48858)

Find related products by research area.

Blogs on CCDC124

There are no specific blogs for CCDC124, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC124 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC124