![Immunocytochemistry/Immunofluorescence: CCDC124 Antibody [NBP2-48858] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/CCDC124-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48858-img0003.jpg "Immunocytochemistry/Immunofluorescence: CCDC124 Antibody [NBP2-48858] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CCDC124 Antibody - BSA Free (NBP2-48858) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CCDC124 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLRE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCDC124 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-48858 | Applications | Species |
|---|---|---|
| Shen W, Qiu Y, Li J, Wu C et al. IL-25 promotes cisplatin resistance of lung cancer cells by activating NF- kappa B signaling pathway to increase of major vault protein Cancer Med 2019-05-01 [PMID: 31044552] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CCDC124 Antibody (NBP2-48858)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCDC124 |
![Immunohistochemistry-Paraffin: CCDC124 Antibody [NBP2-48858] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/CCDC124-Antibody-Immunohistochemistry-Paraffin-NBP2-48858-img0002.jpg "Immunohistochemistry-Paraffin: CCDC124 Antibody [NBP2-48858] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.")
![Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-48858_rabbit-polyclonal-ccdc124-antibody-31020241533491.jpg "Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-48858_rabbit-polyclonal-ccdc124-antibody-310202415384139.jpg "Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CCDC124 Antibody [NBP2-48858] - IL‐25 regulates the NF‐ kappa B signaling pathway activity. A, The change of NF‐ kappa B signaling pathway in IL‐25 overexpressed A549 cells & IL‐25 silenced A549/CDDP cells. B, The effect of exogenous IL‐25 on the activity of NF‐ kappa B signaling pathway in A549 cells. C, QNZ blocks the effect of exogenous IL‐25 on the expression of major vault protein (MVP) & the activity of NF‐ kappa B signaling pathway in A549 cells. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-48858_rabbit-polyclonal-ccdc124-antibody-31020241534376.jpg "Western Blot: CCDC124 Antibody [NBP2-48858] - IL‐25 regulates the NF‐ kappa B signaling pathway activity. A, The change of NF‐ kappa B signaling pathway in IL‐25 overexpressed A549 cells & IL‐25 silenced A549/CDDP cells. B, The effect of exogenous IL‐25 on the activity of NF‐ kappa B signaling pathway in A549 cells. C, QNZ blocks the effect of exogenous IL‐25 on the expression of major vault protein (MVP) & the activity of NF‐ kappa B signaling pathway in A549 cells. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-48858_rabbit-polyclonal-ccdc124-antibody-310202415284510.jpg "Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-48858_rabbit-polyclonal-ccdc124-antibody-310202415284511.jpg "Western Blot: CCDC124 Antibody [NBP2-48858] - The expression of IL‐25 affects the cisplatin resistance of lung cancer cells. A, The expression of IL‐25 in A549 & A549/CDDP cells. B, IL‐25 overexpressed in A549 cells. C, silence of IL‐25 expression by siRNA in A549/CDDP cells. D, IL‐25 overexpression desensitizes A549 cells to cisplatin treatment. E, Silence of IL‐25 expression sensitizes A549/CDDP cells to cisplatin treatment. *P < 0.01 vs indicated controls, all figures represent the average of three sets of independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31044552), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")