CCDC105 Antibody


Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Staining of epididymis.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Staining of epididymis.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Staining of liver cancer.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Staining of liver cancer.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CCDC105 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
CCDC105 Protein (NBP2-32391PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCDC105 Antibody

  • Coiled-Coil Domain Containing 105
  • Coiled-Coil Domain-Containing Protein 105


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC105 Antibody (NBP2-32391) (0)

There are no publications for CCDC105 Antibody (NBP2-32391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC105 Antibody (NBP2-32391) (0)

There are no reviews for CCDC105 Antibody (NBP2-32391). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC105 Antibody (NBP2-32391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC105 Antibody Products

CCDC105 NBP2-32391

Bioinformatics Tool for CCDC105 Antibody (NBP2-32391)

Discover related pathways, diseases and genes to CCDC105 Antibody (NBP2-32391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC105

There are no specific blogs for CCDC105, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC105 Antibody and receive a gift card or discount.


Gene Symbol CCDC105

Customers Who Bought This Also Bought