CCDC105 Antibody

Images

 
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - epididymis
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - epididymis
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - liver cancer
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry: CCDC105 Antibody [NBP2-32391] - liver cancer

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CCDC105 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC105
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
CCDC105 Protein (NBP2-32391PEP)

Alternate Names for CCDC105 Antibody

  • Coiled-Coil Domain Containing 105
  • Coiled-Coil Domain-Containing Protein 105

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC105 Antibody (NBP2-32391) (0)

There are no publications for CCDC105 Antibody (NBP2-32391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC105 Antibody (NBP2-32391) (0)

There are no reviews for CCDC105 Antibody (NBP2-32391). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC105 Antibody (NBP2-32391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC105 Antibody Products

CCDC105 NBP2-32391

Bioinformatics Tool for CCDC105 Antibody (NBP2-32391)

Discover related pathways, diseases and genes to CCDC105 Antibody (NBP2-32391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC105

There are no specific blogs for CCDC105, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CCDC105

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32391 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought