New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

CCDC102B Antibody

Images

 
Western Blot: CCDC102B Antibody [NBP2-87139] - WB Suggested Anti-CCDC102B Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC102B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of CCDC102B. Peptide sequence: TANWREKWSKVRAERNSAREEGRQLRIKLEMAMKELSTLKKKQSLPPQKE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC102B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC102B Antibody

  • ACY1L
  • aminoacylase 1-like
  • AN
  • C18orf14
  • chromosome 18 open reading frame 14
  • coiled-coil domain containing 102B
  • coiled-coil domain-containing protein 102B
  • DKFZp434K1426
  • DKFZp686I08254
  • FLJ23594
  • HsT1731
  • MGC161726
  • MGC161728

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92550
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-56370
Species: Hu
Applications: ICC/IF, WB
NBP2-87139
Species: Hu
Applications: WB

Publications for CCDC102B Antibody (NBP2-87139) (0)

There are no publications for CCDC102B Antibody (NBP2-87139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC102B Antibody (NBP2-87139) (0)

There are no reviews for CCDC102B Antibody (NBP2-87139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC102B Antibody (NBP2-87139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC102B Products

Bioinformatics Tool for CCDC102B Antibody (NBP2-87139)

Discover related pathways, diseases and genes to CCDC102B Antibody (NBP2-87139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC102B Antibody (NBP2-87139)

Discover more about diseases related to CCDC102B Antibody (NBP2-87139).
 

Pathways for CCDC102B Antibody (NBP2-87139)

View related products by pathway.

Blogs on CCDC102B

There are no specific blogs for CCDC102B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC102B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC102B