Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
![Western Blot: CCDC102B Antibody [NBP2-87139] - WB Suggested Anti-CCDC102B Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell](http://images.novusbio.com/fullsize2/CCDC102B-Antibody-Western-Blot-NBP2-87139-img0001.jpg "Western Blot: CCDC102B Antibody [NBP2-87139] - WB Suggested Anti-CCDC102B Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of CCDC102B. Peptide sequence: TANWREKWSKVRAERNSAREEGRQLRIKLEMAMKELSTLKKKQSLPPQKE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCDC102B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: TXNDC10 Antibody [NBP1-92550] - Analysis in human cell lines U-251MG and MCF-7 using anti-TMX3 antibody. Corresponding TMX3 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/images2/TXNDC10-Antibody-Western-Blot-NBP1-92550-img0008.jpg)
![Western Blot: TXNDC10 Antibody [NBP1-92550] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/TXNDC10-Antibody-Western-Blot-NBP1-92550-img0009.jpg)
![Western Blot: TXNDC10 Antibody [NBP1-92550] - Analysis in human cell line U-138MG.](http://images.novusbio.com/images2/TXNDC10-Antibody-Western-Blot-NBP1-92550-img0011.jpg)
![Western Blot: DSEL Antibody [NBP2-56370] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/images2/DSEL-Antibody-Western-Blot-NBP2-56370-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: DSEL Antibody [NBP2-56370] - Staining of human cell line BJ shows localization to plasma membrane.](http://images.novusbio.com/images2/DSEL-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56370-img0001.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for CCDC102B Antibody (NBP2-87139)Discover more about diseases related to CCDC102B Antibody (NBP2-87139).
| Pathways for CCDC102B Antibody (NBP2-87139)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCDC102B |
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
