CCDC102A Antibody


Immunocytochemistry/ Immunofluorescence: CCDC102A Antibody [NBP1-82766] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: CCDC102A Antibody [NBP1-82766] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CCDC102A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD
Specificity of human CCDC102A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC102A Protein (NBP1-82766PEP)
Read Publication using NBP1-82766.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCDC102A Antibody

  • coiled-coil domain containing 102A
  • coiled-coil domain-containing protein 102A
  • MGC10992
  • MGC13119


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC102A Antibody (NBP1-82766)(1)

Reviews for CCDC102A Antibody (NBP1-82766) (0)

There are no reviews for CCDC102A Antibody (NBP1-82766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC102A Antibody (NBP1-82766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CCDC102A Antibody (NBP1-82766)

Discover related pathways, diseases and genes to CCDC102A Antibody (NBP1-82766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC102A

There are no specific blogs for CCDC102A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC102A Antibody and receive a gift card or discount.


Gene Symbol CCDC102A