CASC4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CASC4 Antibody [NBP2-30507] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30507] - Staining of human liver.

Immunohistochemistry: CASC4 Antibody [NBP2-30507] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30507] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-CASC4 antibody NBP2-30507 (A) shows similar protein distribution across tissues to independent antibody NBP2-30492 (B).

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30507] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30507] - Staining of human pancreas.

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30507] - Staining of human lymph node.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CASC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CASC4 Antibody - BSA Free (NBP2-30507) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CASC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CASC4 Protein (NBP2-30507PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CASC4 Antibody - BSA Free

• cancer susceptibility candidate 4
• Cancer susceptibility candidate gene 4 protein
• DKFZp459F1927
• gene associated with HER-2/neu overexpression
• H63
• MGC74708
• protein CASC4

Background

The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Further characterization of the product of this gene may yield insight into the fundamental biology and pathogenetic effects of HER-2/neu overexpression in human breast and ovarian cancer cells. Alternatively spliced variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CASC4
• Uniprot:
  • Q6P4E1(Human)