Cadherin-26 Recombinant Protein Antigen

Images

 
There are currently no images for Cadherin-26 Recombinant Protein Antigen (NBP2-57189PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cadherin-26 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cadherin-26.

Source: E. coli

Amino Acid Sequence: YFVLEPKRHGCSVSNDEGHQTLVMYNAESKGTSAQTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57189.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cadherin-26 Recombinant Protein Antigen

  • cadherin 26
  • cadherin-like 26
  • cadherin-like protein 26
  • Cadherin-like protein VR20
  • VR20

Background

Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization and migration. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. This gene encodes a cadherin domain-containing protein whose specific function has not yet been determined. Alternative splicing occurs at this locus and two transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
7754-BH/CF
Species: Hu
Applications: BA
AF1717
Species: Hu
Applications: IP, WB
NBP2-31807
Species: Hu
Applications: IHC,  IHC-P
MAB4974
Species: Hu
Applications: IHC
MAB342
Species: Hu
Applications: AgAct, ICC, WB
AF169
Species: Hu
Applications: IHC, WB
NLS476
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67246
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Cadherin-26 Recombinant Protein Antigen (NBP2-57189PEP) (0)

There are no publications for Cadherin-26 Recombinant Protein Antigen (NBP2-57189PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-26 Recombinant Protein Antigen (NBP2-57189PEP) (0)

There are no reviews for Cadherin-26 Recombinant Protein Antigen (NBP2-57189PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cadherin-26 Recombinant Protein Antigen (NBP2-57189PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-26 Products

Blogs on Cadherin-26

There are no specific blogs for Cadherin-26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cadherin-26 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH26