C9orf40 Antibody

Western Blot: C9orf40 Antibody [NBP1-90447] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: C9orf40 Antibody [NBP1-90447] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome.

Immunohistochemistry-Paraffin: C9orf40 Antibody [NBP1-90447] - Staining in human testis and skeletal muscle tissues using anti-C9orf40 antibody. Corresponding C9orf40 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: C9orf40 Antibody [NBP1-90447] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: C9orf40 Antibody [NBP1-90447] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: C9orf40 Antibody [NBP1-90447] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C9orf40 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VASRQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDME
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C9ORF40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  C9orf40 Protein (NBP1-90447PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C9orf40 Antibody

• chromosome 9 open reading frame 40
• FLJ25795

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C9ORF40