C8orf48 Antibody

Western Blot: C8orf48 Antibody [NBP1-93918] - Analysis in control (vector only transfected HEK293T lysate) and C8orf48 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: C8orf48 Antibody [NBP1-93918] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: C8orf48 Antibody [NBP1-93918] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C8orf48 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DFLTRIGEAHQDFPRLSDDPRIIWKRLTEKSHIRYSGFERSETEQKMQRDGNSACHLPFSLPFLKRLTLIKPELVIVNDNV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C8orf48
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  C8orf48 Protein (NBP1-93918PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C8orf48 Antibody

• chromosome 8 open reading frame 48
• FLJ25402

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C8orf48