C5orf51 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C5orf51 Antibody [NBP2-32025] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: C5orf51 Antibody [NBP2-32025] - Staining of human liver shows strong cytoplasmic positivity (granular pattern) in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C5orf51 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C5ORF51
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C5orf51 Protein (NBP2-32025PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-32025 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C5orf51 Antibody

  • chromosome 5 open reading frame 51
  • hypothetical protein LOC285636
  • LOC285636
  • UPF0600 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C5orf51 Antibody (NBP2-32025) (0)

There are no publications for C5orf51 Antibody (NBP2-32025).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for C5orf51 Antibody (NBP2-32025) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP2-32025:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin C5orf51 NBP2-32025
Enlarge
reviewed by:
Anonymous
IHC-P Mouse 09/22/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedLiver
SpeciesMouse
LotlotR00318

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C5orf51 Antibody (NBP2-32025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C5orf51 Products

Bioinformatics Tool for C5orf51 Antibody (NBP2-32025)

Discover related pathways, diseases and genes to C5orf51 Antibody (NBP2-32025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C5orf51

There are no specific blogs for C5orf51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/22/2017
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol C5ORF51
Uniprot