We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

C2orf69 Antibody - BSA Free

Images

 
Western Blot: C2orf69 Antibody [NBP1-91731] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: C2orf69 Antibody [NBP1-91731] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: C2orf69 Antibody [NBP1-91731] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: C2orf69 Antibody [NBP1-91731] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

C2orf69 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEH
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C2ORF69
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C2orf69 Recombinant Protein Antigen (NBP1-91731PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for C2orf69 Antibody - BSA Free

  • chromosome 2 open reading frame 69
  • FLJ38973
  • hypothetical protein LOC205327

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C2orf69 Antibody (NBP1-91731) (0)

There are no publications for C2orf69 Antibody (NBP1-91731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2orf69 Antibody (NBP1-91731) (0)

There are no reviews for C2orf69 Antibody (NBP1-91731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C2orf69 Antibody (NBP1-91731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C2orf69 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol C2ORF69