C2CD4C Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C2CD4C Antibody [NBP2-30575] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Immunohistochemistry-Paraffin: C2CD4C Antibody [NBP2-30575] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neuropil.
Immunohistochemistry: C2CD4C Antibody [NBP2-30575] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C2CD4C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPSVPKAQTSYGFAMLAES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C2CD4C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C2CD4C Protein (NBP2-30575PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C2CD4C Antibody

  • C2 Calcium-Dependent Domain Containing 4C
  • C2 Calcium-Dependent Domain-Containing Protein 4C
  • FAM148C
  • Family With Sequence Similarity 148, Member C
  • KIAA1957
  • NLF3
  • Nuclear Localized Factor 3
  • Nuclear-Localized Factor 3
  • Protein FAM148C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C2CD4C Antibody (NBP2-30575) (0)

There are no publications for C2CD4C Antibody (NBP2-30575).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2CD4C Antibody (NBP2-30575) (0)

There are no reviews for C2CD4C Antibody (NBP2-30575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C2CD4C Antibody (NBP2-30575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C2CD4C Products

C2CD4C NBP2-30575

Bioinformatics Tool for C2CD4C Antibody (NBP2-30575)

Discover related pathways, diseases and genes to C2CD4C Antibody (NBP2-30575). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C2CD4C

There are no specific blogs for C2CD4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C2CD4C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C2CD4C
Uniprot