C21orf59 Antibody


Immunocytochemistry/ Immunofluorescence: C21orf59 Antibody [NBP1-88275] - Staining of mouse rostral migratory stream shows strong immunoreactivity in the subventricular zone.
Immunohistochemistry-Paraffin: C21orf59 Antibody [NBP1-88275] - Staining of human fallopian tube shows strong positivity in a subset of glandular cells.
Immunocytochemistry/ Immunofluorescence: C21orf59 Antibody [NBP1-88275] - Staining of mouse hippocampus shows labeling of the CA3 neurons and their dendrites.
Immunocytochemistry/ Immunofluorescence: C21orf59 Antibody [NBP1-88275] - Staining of mouse cerebellum shows strong immunoreactivity in Purkinje cells.
Immunocytochemistry/ Immunofluorescence: C21orf59 Antibody [NBP1-88275] - Staining of mouse olfactory bulb shows labeling of dendrites and cell bodies in the external plexiform layer.
Immunohistochemistry-Paraffin: C21orf59 Antibody [NBP1-88275] - Staining of human ovary shows strong positivity in follicle cells.
Immunohistochemistry-Paraffin: C21orf59 Antibody [NBP1-88275] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.

Product Details

Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

C21orf59 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE
Specificity of human, mouse C21orf59 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C21orf59 Protein (NBP1-88275PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C21orf59 Antibody

  • C21orf48
  • chromosome 21 open reading frame 48
  • chromosome 21 open reading frame 59
  • FLJ20467
  • FLJ37137
  • FLJ40247
  • hypothetical protein LOC56683


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C21orf59 Antibody (NBP1-88275) (0)

There are no publications for C21orf59 Antibody (NBP1-88275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C21orf59 Antibody (NBP1-88275) (0)

There are no reviews for C21orf59 Antibody (NBP1-88275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C21orf59 Antibody (NBP1-88275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for C21orf59 Antibody (NBP1-88275)

Discover related pathways, diseases and genes to C21orf59 Antibody (NBP1-88275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for C21orf59 Antibody (NBP1-88275)

Find related products by research area.

Blogs on C21orf59

There are no specific blogs for C21orf59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C21orf59 Antibody and receive a gift card or discount.


Gene Symbol C21ORF59