We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

C21orf59 Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: C21orf59 Antibody [NBP1-88275] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
Immunohistochemistry-Paraffin: C21orf59 Antibody [NBP1-88275] - Staining of human fallopian tube shows strong positivity in a subset of glandular cells.
Staining of human cerebellum shows positivity in Purkinje cells, including processes.
Immunohistochemistry: C21orf59 Antibody [NBP1-88275] - Staining of mouse rostral migratory stream shows strong immunoreactivity in the subventricular zone.
Immunohistochemistry: C21orf59 Antibody [NBP1-88275] - Staining of mouse hippocampus shows labeling of the CA3 neurons and their dendrites.
Immunohistochemistry: C21orf59 Antibody [NBP1-88275] - Staining of mouse cerebellum shows strong immunoreactivity in Purkinje cells.
Immunohistochemistry: C21orf59 Antibody [NBP1-88275] - Staining of mouse olfactory bulb shows labeling of dendrites and cell bodies in the external plexiform layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

C21orf59 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFAP298
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C21orf59 Recombinant Protein Antigen (NBP1-88275PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for C21orf59 Antibody - BSA Free

  • C21orf48
  • chromosome 21 open reading frame 48
  • chromosome 21 open reading frame 59
  • FLJ20467
  • FLJ37137
  • FLJ40247
  • hypothetical protein LOC56683
  • kur
  • kurly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C21orf59 Antibody (NBP1-88275) (0)

There are no publications for C21orf59 Antibody (NBP1-88275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C21orf59 Antibody (NBP1-88275) (0)

There are no reviews for C21orf59 Antibody (NBP1-88275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C21orf59 Antibody (NBP1-88275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C21orf59 Products

Research Areas for C21orf59 Antibody (NBP1-88275)

Find related products by research area.

Blogs on C21orf59

There are no specific blogs for C21orf59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C21orf59 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CFAP298