C1orf87 Antibody

Images

 
Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human testis.
Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human nasopharynx shows strong positivity in cilia of respiratory epithelial cells.
Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human placenta shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining in human fallopian tube and placenta tissues using anti-C1orf87 antibody. Corresponding C1orf87 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human fallopian tube, kidney, lymph node and testis using Anti-C1orf87 antibody NBP2-48611 (A) shows similar ...read more
Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human kidney.
Immunohistochemistry-Paraffin: C1orf87 Antibody [NBP2-48611] - Staining of human lymph node.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1orf87 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVRAICGKHGLYLTLSLLETLLNHQDLGYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1ORF87
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C1orf87 Recombinant Protein Antigen (NBP2-48611PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1orf87 Antibody

  • chromosome 1 open reading frame 87
  • FLJ44073
  • hypothetical protein LOC127795
  • MGC34837

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C1orf87 Antibody (NBP2-48611) (0)

There are no publications for C1orf87 Antibody (NBP2-48611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1orf87 Antibody (NBP2-48611) (0)

There are no reviews for C1orf87 Antibody (NBP2-48611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C1orf87 Antibody (NBP2-48611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1orf87 Products

Bioinformatics Tool for C1orf87 Antibody (NBP2-48611)

Discover related pathways, diseases and genes to C1orf87 Antibody (NBP2-48611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C1orf87

There are no specific blogs for C1orf87, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1orf87 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF87