C19orf81 Antibody


Immunocytochemistry/ Immunofluorescence: C19orf81 Antibody [NBP2-32518] - Staining of human cell line HEK 293 shows localization to aggresome & vesicles.
Immunohistochemistry-Paraffin: C19orf81 Antibody [NBP2-32518] - Staining in human testis and endometrium tissues using anti-C19orf81 antibody. Corresponding C19orf81 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: C19orf81 Antibody [NBP2-32518] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: C19orf81 Antibody [NBP2-32518] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

C19orf81 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RNRWLIAVTDFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA
Specificity of human C19orf81 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C19orf81 Protein (NBP2-32518PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C19orf81 Antibody

  • Chromosome 19 Open Reading Frame 81
  • Putative Uncharacterized Protein C19orf81


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C19orf81 Antibody (NBP2-32518) (0)

There are no publications for C19orf81 Antibody (NBP2-32518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C19orf81 Antibody (NBP2-32518) (0)

There are no reviews for C19orf81 Antibody (NBP2-32518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C19orf81 Antibody (NBP2-32518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C19orf81 Products

C19orf81 NBP2-32518

Bioinformatics Tool for C19orf81 Antibody (NBP2-32518)

Discover related pathways, diseases and genes to C19orf81 Antibody (NBP2-32518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C19orf81

There are no specific blogs for C19orf81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C19orf81 Antibody and receive a gift card or discount.


Gene Symbol C19orf81