BTNL3 Antibody

Images

 
Western Blot: BTNL3 Antibody [NBP1-69346] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml
Western Blot: BTNL3 Antibody [NBP1-69346] - This Anti-BTNL3 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.
Western Blot: BTNL3 Antibody [NBP1-69346] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTNL3 Antibody Summary

Immunogen
Synthetic peptides corresponding to BTNL3(butyrophilin-like 3) The peptide sequence was selected from the N terminal of BTNL3. Peptide sequence EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTNL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BTNL3 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BTNL3 Antibody

  • BTN9.1
  • BTNL3
  • BTNLR
  • BTNLRButyrophilin-like receptor
  • butyrophilin-like 3
  • butyrophilin-like protein 3
  • COLF4100

Background

The specific function of BTNL3 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69346
Species: Hu
Applications: WB

Publications for BTNL3 Antibody (NBP1-69346) (0)

There are no publications for BTNL3 Antibody (NBP1-69346).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTNL3 Antibody (NBP1-69346) (0)

There are no reviews for BTNL3 Antibody (NBP1-69346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTNL3 Antibody (NBP1-69346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTNL3 Products

Bioinformatics Tool for BTNL3 Antibody (NBP1-69346)

Discover related pathways, diseases and genes to BTNL3 Antibody (NBP1-69346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BTNL3

There are no specific blogs for BTNL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTNL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTNL3
Entrez
Uniprot