BICRAL Antibody


Immunocytochemistry/ Immunofluorescence: KIAA0240 Antibody [NBP1-86359] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KIAA0240 Antibody [NBP1-86359] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: KIAA0240 Antibody [NBP1-86359] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: KIAA0240 Antibody [NBP1-86359] - Staining of human rectum shows moderate to strong nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

BICRAL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MFNQEERASLSRDKRLALVDPEGFQADFCCSFKLDKAAHETQFGRSDQHGSKASSSLQPPAKAQGRDRAKTGVTEPMN
Specificity of human KIAA0240 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BICRAL Antibody

  • DKFZp686P0250
  • hypothetical protein LOC23506
  • KIAA0240


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BICRAL Antibody (NBP1-86359) (0)

There are no publications for BICRAL Antibody (NBP1-86359).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BICRAL Antibody (NBP1-86359) (0)

There are no reviews for BICRAL Antibody (NBP1-86359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BICRAL Antibody (NBP1-86359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional BICRAL Products

Bioinformatics Tool for BICRAL Antibody (NBP1-86359)

Discover related pathways, diseases and genes to BICRAL Antibody (NBP1-86359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BICRAL

There are no specific blogs for BICRAL, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BICRAL Antibody and receive a gift card or discount.


Gene Symbol GLTSCR1L
Novus 100% Guarantee