BAP18 Antibody - BSA Free

Images

 
Western Blot: BAP18 Antibody [NBP1-82670] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: BAP18 Antibody [NBP1-82670] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BAP18 Antibody [NBP1-82670] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: BAP18 Antibody [NBP1-82670] - Staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: BAP18 Antibody [NBP1-82670] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: BAP18 Antibody [NBP1-82670] - Staining of human cerebral cortex shows weak to moderate nuclear positivity in neurons and glial cells.
ChIP-Exo-Seq composite graph for Anti-BAP18 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

BAP18 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFD
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BACC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BAP18 Protein (NBP1-82670PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BAP18 Antibody - BSA Free

  • BAP18
  • BPTF-associated protein of 18 kDa
  • chromatin complexes subunit BAP18
  • chromosome 17 open reading frame 49
  • MGC49942
  • MLL1/MLL complex subunit C17orf49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BAP18 Antibody (NBP1-82670) (0)

There are no publications for BAP18 Antibody (NBP1-82670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAP18 Antibody (NBP1-82670) (0)

There are no reviews for BAP18 Antibody (NBP1-82670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BAP18 Antibody (NBP1-82670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAP18 Products

Research Areas for BAP18 Antibody (NBP1-82670)

Find related products by research area.

Blogs on BAP18

There are no specific blogs for BAP18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAP18 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol BACC1