We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human B3GALT1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related B3GALT1 Peptides and Proteins

Order Details


    • Catalog Number
      H00008708-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human B3GALT1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 59-150 of Human B3GALT1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
B3GALT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human B3GALT1 GST (N-Term) Protein

  • beta-1,3-galactosyltransferase 1
  • Beta-1,3-GalTase 1
  • beta3GalT1
  • beta-3-galt1
  • beta3Gal-T1
  • EC 2.4.1
  • EC 2.4.1.-
  • EC 2.4.1.62
  • MGC126594
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1
  • UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1

Background

This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-41994
Species: Hu
Applications: IHC, WB
NBP3-47900
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB500-526
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
H00126792-B01P-50ug
Species: Hu
Applications: ICC/IF, WB
MAB161
Species: Hu
Applications: AdBlk, COMET, CyTOF-ready, Flow, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
4949-GT
Species: Hu
Applications: EnzAct
7770-GT
Species: Hu
Applications: EnzAct
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00008708-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for B3GALT1 Partial Recombinant Protein (H00008708-Q01) (0)

There are no publications for B3GALT1 Partial Recombinant Protein (H00008708-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALT1 Partial Recombinant Protein (H00008708-Q01) (0)

There are no reviews for B3GALT1 Partial Recombinant Protein (H00008708-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALT1 Partial Recombinant Protein (H00008708-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B3GALT1 Products

Array H00008708-Q01

Blogs on B3GALT1

There are no specific blogs for B3GALT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human B3GALT1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALT1