ATP8B2 Antibody

Images

 
Western Blot: ATP8B2 Antibody [NBP1-57018] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP8B2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ATP8B2 (ATPase, class I, type 8B, member 2) The peptide sequence was selected from the N terminal of ATP8B2. Peptide sequence MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP8B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ATP8B2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP8B2 Antibody

  • ATPase, class I, type 8B, member 2
  • ATPIDprobable phospholipid-transporting ATPase ID
  • DKFZp434M0219
  • EC 3.6.3
  • EC 3.6.3.1
  • KIAA1137ATPase class I type 8B member 2
  • phospholipid-transporting ATPase ID

Background

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90068
Species: Hu
Applications: IHC, IHC-P
NBP2-05627
Species: Hu
NBP1-59534
Species: Hu
Applications: WB
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59474
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55197
Species: Hu
Applications: ICC/IF
H00079895-M08
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-57018
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for ATP8B2 Antibody (NBP1-57018) (0)

There are no publications for ATP8B2 Antibody (NBP1-57018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP8B2 Antibody (NBP1-57018) (0)

There are no reviews for ATP8B2 Antibody (NBP1-57018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP8B2 Antibody (NBP1-57018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP8B2 Products

Bioinformatics Tool for ATP8B2 Antibody (NBP1-57018)

Discover related pathways, diseases and genes to ATP8B2 Antibody (NBP1-57018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP8B2 Antibody (NBP1-57018)

Discover more about diseases related to ATP8B2 Antibody (NBP1-57018).
 

Pathways for ATP8B2 Antibody (NBP1-57018)

View related products by pathway.

PTMs for ATP8B2 Antibody (NBP1-57018)

Learn more about PTMs related to ATP8B2 Antibody (NBP1-57018).

Blogs on ATP8B2

There are no specific blogs for ATP8B2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP8B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP8B2