ATP6V0E2 Antibody - BSA Free

Western Blot: ATP6V0E2 Antibody [NBP2-83944] - Host: Rabbit. Target Name: ATP6V0E2. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP6V0E2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0E2. Peptide sequence: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0E2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6V0E2 Antibody - BSA Free

• ATP6V0
• ATPase, H+ transporting V0 subunit e2
• chromosome 7 open reading frame 32
• H+ transporting V0 subunit E isoform 2-like (rat)
• Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2

Background

Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles,clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found inplasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and spermmaturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transportH+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodesan isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al., 2007 (PubMed17350184)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V0E2