ATP6AP1L Antibody


Immunocytochemistry/ Immunofluorescence: ATP6AP1L Antibody [NBP2-30899] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: ATP6AP1L Antibody [NBP2-30899] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ATP6AP1L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6AP1L Protein (NBP2-30899PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP6AP1L Antibody

  • ATPase, H+ transporting, lysosomal accessory protein 1-like
  • MGC138396
  • vacuolar proton pump subunit S1-like protein
  • V-type proton ATPase subunit S1-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6AP1L Antibody (NBP2-30899) (0)

There are no publications for ATP6AP1L Antibody (NBP2-30899).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6AP1L Antibody (NBP2-30899) (0)

There are no reviews for ATP6AP1L Antibody (NBP2-30899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP6AP1L Antibody (NBP2-30899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATP6AP1L Products

Bioinformatics Tool for ATP6AP1L Antibody (NBP2-30899)

Discover related pathways, diseases and genes to ATP6AP1L Antibody (NBP2-30899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ATP6AP1L

There are no specific blogs for ATP6AP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6AP1L Antibody and receive a gift card or discount.


Gene Symbol ATP6AP1L