ARPC5L Antibody


Immunohistochemistry-Paraffin: ARPC5L Antibody [NBP1-89017] - Staining of human appendix shows cytoplasmic positivity in germinal center.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

ARPC5L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARPC5L Protein (NBP1-89017PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARPC5L Antibody

  • actin related protein 2/3 complex, subunit 5-like
  • actin-related protein 2/3 complex subunit 5-like protein
  • ARC16-2MGC3038
  • Arp2/3 complex 16 kDa subunit 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARPC5L Antibody (NBP1-89017) (0)

There are no publications for ARPC5L Antibody (NBP1-89017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARPC5L Antibody (NBP1-89017) (0)

There are no reviews for ARPC5L Antibody (NBP1-89017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARPC5L Antibody (NBP1-89017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARPC5L Products

Bioinformatics Tool for ARPC5L Antibody (NBP1-89017)

Discover related pathways, diseases and genes to ARPC5L Antibody (NBP1-89017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ARPC5L

There are no specific blogs for ARPC5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARPC5L Antibody and receive a gift card or discount.


Gene Symbol ARPC5L