Recombinant Human ARL8A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARL8A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 186 of Human ARL8A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Protein/Peptide Type
Recombinant Protein
Gene
ARL8A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARL8A Protein

  • ADP-ribosylation factor-like 10B
  • ADP-ribosylation factor-like 8A
  • ADP-ribosylation factor-like protein 10B
  • ADP-ribosylation factor-like protein 8A
  • ARL10B
  • FLJ45195
  • GIE2
  • Novel small G protein indispensable for equal chromosome segregation 2
  • small G protein indispensable for equal chromosome segregation 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56577
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for ARL8A Recombinant Protein (H00127829-P02) (0)

There are no publications for ARL8A Recombinant Protein (H00127829-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL8A Recombinant Protein (H00127829-P02) (0)

There are no reviews for ARL8A Recombinant Protein (H00127829-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL8A Recombinant Protein (H00127829-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL8A Products

Bioinformatics Tool for ARL8A Recombinant Protein (H00127829-P02)

Discover related pathways, diseases and genes to ARL8A Recombinant Protein (H00127829-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ARL8A Recombinant Protein (H00127829-P02)

View related products by pathway.

PTMs for ARL8A Recombinant Protein (H00127829-P02)

Learn more about PTMs related to ARL8A Recombinant Protein (H00127829-P02).
 

Research Areas for ARL8A Recombinant Protein (H00127829-P02)

Find related products by research area.

Blogs on ARL8A

There are no specific blogs for ARL8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ARL8A Antibody
NBP2-14316

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARL8A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL8A